DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AKR1A1

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001189342.1 Gene:AKR1A1 / 10327 HGNCID:380 Length:325 Species:Homo sapiens


Alignment Length:317 Identity:126/317 - (39%)
Similarity:190/317 - (59%) Gaps:17/317 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEG-VIKRE 74
            :.|.::..|||||:.|..|..:.|..:|:.|||||||.|..|.||.|:|.|::..:..| .:.||
Human     9 HTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPRE 73

  Fly    75 DIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGEVELN 139
            ::.:|:|||...|.|:.||.|.||||.:..|:|:|||||||||:: .||||. .|.:|.|.:..:
Human    74 ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAF-ERGDNP-FPKNADGTICYD 136

  Fly   140 DIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLIALCK 204
            ...|.:||:.:|.||..||.:::|:|||||.|:..:|:...::|...|:||||.|.|.:|||.|:
Human   137 STHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQ 201

  Fly   205 KNDIVVTAYCPLGRPNPAEKTPN---YIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSSN 266
            ...:.||||.|||..:.|.:.|:   .:.:..|.|:.:||.:|.||::||:.::...|.:|||..
Human   202 ARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSIT 266

  Fly   267 PKRIEENFQIFDFQLDAEDHAILDSYNTGER-LIPMTHAIKSKN---------YPFN 313
            |.||.:|.::|||....|:...|::.|...| ::||. .:..|.         ||||
Human   267 PSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPML-TVDGKRVPRDAGHPLYPFN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 121/297 (41%)
Tas 11..290 CDD:223739 116/282 (41%)
AKR1A1NP_001189342.1 ARA1 6..303 CDD:223729 120/295 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.