DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AAD15

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_014477.1 Gene:AAD15 / 853999 SGDID:S000005525 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:134 Identity:29/134 - (21%)
Similarity:52/134 - (38%) Gaps:33/134 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IGLGTFASTE--------GDCERAVLHA-------IDVGYRHIDTAYFYGNEAEVGAA---VRKK 66
            :|.|.|.|.:        |:|.|:.:.|       |.:.......|..:|.|:....|   ||.|
Yeast    15 MGGGRFQSKKAMEERRKNGECIRSFVGASEQTDAEIKISEALAKVAEEHGTESVTAIAIAYVRSK 79

  Fly    67 IAEGVI------KREDIFITTKLWCNFHEPERVEYACRKTLKNI---GLDYVDLYLIHWPFSYKY 122
             |:.|.      |.||:....|.......|:.::|     |:|:   .:.:.:.:::....:.||
Yeast    80 -AKNVFPSVEGGKIEDLKENIKALSIDLTPDNIKY-----LENVVPFDIGFPNTFIVLNSLTQKY 138

  Fly   123 RGDN 126
            ..:|
Yeast   139 GTNN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 29/134 (22%)
Tas 12..299 CDD:223739 29/134 (22%)
AAD15NP_014477.1 AKR_SF <1..115 CDD:412396 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.