DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and ARA1

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_009707.3 Gene:ARA1 / 852446 SGDID:S000000353 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:118/285 - (41%)
Similarity:172/285 - (60%) Gaps:27/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EYYFKHNDGTHIQGIGLGTFASTE--GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIA 68
            |.||..|:|..|..:||||....|  .:.::||..||..||||||||:.|..|..||.|:::.:.
Yeast    22 EIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLE 86

  Fly    69 EGVIKREDIFITTKLWCNFHEP---ERVEYACRKTLKNIGLDYVDLYLIHWPFSYKY----RGDN 126
            :|.|||||:|||||:|     |   :.|:.:..::||.:||:||||.|.|||..::.    :|.:
Yeast    87 DGSIKREDLFITTKVW-----PVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEKIKDPKGIS 146

  Fly   127 ELI--PKDANGE-VELVDIDYLDTWGAMEKL-VDLG--LTKSIGVSNFNEEQLTRLLANCKIKPI 185
            .|:  |.|.:|: :...|.|||:|:..:||: :|..  ..::||||||:.|.|.||:..|::||.
Yeast   147 GLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPT 211

  Fly   186 HNQIEVHPALDQKKLIALCKKNGILVTAFSPLGRHNA-ELRTPTFMYDGKVQAIADKYNKSIAQV 249
            .||:|.||.|.|.:|...|..:.||:||:||||.|.| .|:.|.      |:.:|:|||.:...:
Yeast   212 VNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPL------VKKLAEKYNVTGNDL 270

  Fly   250 VIRYVIELGTIPLPKSSNPKRIEEN 274
            :|.|.|..|||.:|:|.||.||..:
Yeast   271 LISYHIRQGTIVIPRSLNPVRISSS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 118/285 (41%)
Tas 12..299 CDD:223739 115/279 (41%)
ARA1NP_009707.3 AKR_AKR3C1 22..321 CDD:381345 118/285 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.