DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AAD4

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_010038.1 Gene:AAD4 / 851354 SGDID:S000002402 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:62/330 - (18%)
Similarity:116/330 - (35%) Gaps:108/330 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAE---VGAAVR-KKIAEGVIKREDIFITTK 82
            |..|....|:|              ||||..|.||..   :|..:: :|:      |:.|.|.||
Yeast    13 LDAFYEAGGNC--------------IDTANSYQNEESEIWIGEWMKSRKL------RDQIVIATK 57

  Fly    83 L----------------WCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPK 131
            .                :|..|: ..:..:.|.:|:.:..|::|:..:||   :.|....|    
Yeast    58 FTGDYKKYEVGGGKSANYCGNHK-HSLHVSVRDSLRKLQTDWIDILYVHW---WDYMSSIE---- 114

  Fly   132 DANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVS----------NF---NEEQLTRLLANCKIK 183
                  |::|        ::..||..|....:|||          |:   :..:....:...|..
Yeast   115 ------EVMD--------SLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQGKWN 165

  Fly   184 PIHNQIEVHPALDQKKLIALCKKNGILVTAFSPLG-------------RHNAE-LRT---PTFMY 231
            .::...|       :.:|.:.:..|:.:..:..:|             :.|.| |||   .:...
Yeast   166 VLNRDFE-------RDIIPMARHFGMALAPWDVMGGGRFQSKKAMEERKKNGEGLRTVSGTSKQT 223

  Fly   232 DGKVQ------AIADKY-NKSIAQVVIRYVIE--LGTIPLPKSSNPKRIEENFNVFDFKLDAEDH 287
            |.:|:      .:|::: .:|:..:.|.||..  ....||......:.:::|......||..|..
Yeast   224 DKEVKISEALAKVAEEHGTESVTAIAIAYVRSKAKNVFPLVGGRKIEHLKQNIEALSIKLTPEQI 288

  Fly   288 AILDS 292
            ..|:|
Yeast   289 EYLES 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 62/330 (19%)
Tas 12..299 CDD:223739 62/330 (19%)
AAD4NP_010038.1 AKR_AKR9A3_9B1-4 1..292 CDD:381373 60/327 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.