DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AAD3

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_010032.1 Gene:AAD3 / 850471 SGDID:S000000704 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:59/317 - (18%)
Similarity:109/317 - (34%) Gaps:106/317 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVGYRHIDTAYFYGNEAE---VGAAVRKKIAEGVIKREDIFITTKL----------------WCN 86
            :.|...||.|....||..   :|..::.:..     |:.|.|.||.                :|.
Yeast    61 EAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-----RDQIVIATKFIKSDKKYKAGESNTANYCG 120

  Fly    87 FHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTWGAM 151
            .|: ..:..:.|.:|:.:..|::|:..:||   :.|....|               :::|   ::
Yeast   121 NHK-RSLHVSVRDSLRKLQTDWIDILYVHW---WDYMSSIE---------------EFMD---SL 163

  Fly   152 EKLVDLGLTKSIGVSN--------------------FNEEQ-----LTRLLANCKIKPI--HNQI 189
            ..||..|....:|||:                    |:..|     |.|.... .|.|:  |..:
Yeast   164 HILVQQGKVLYLGVSDTPAWVVSAANYYATSYGKTPFSIYQGKWNVLNRDFER-DIIPMARHFGM 227

  Fly   190 EVHP-------ALDQKKLIALCKKNGILVTAFSPLGRH-NAELRTPTFMYDGKVQAIADKY-NKS 245
            .:.|       ....||.:...:|||..:.:|...... :||::     ....:..||::: .:|
Yeast   228 ALAPWDVMGGGRFQSKKAMEERRKNGEGIRSFVGASEQTDAEIK-----ISEALAKIAEEHGTES 287

  Fly   246 IAQVVIRYV----------IELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDS 292
            :..:.|.||          :|.|.|        :.::||.......|..::...|:|
Yeast   288 VTAIAIAYVRSKAKNFFPSVEGGKI--------EDLKENIKALSIDLTPDNIKYLES 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 59/317 (19%)
Tas 12..299 CDD:223739 59/317 (19%)
AAD3NP_010032.1 AKR_AKR9A3_9B1-4 17..335 CDD:381373 57/314 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.