DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AT5G62420

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_201048.1 Gene:AT5G62420 / 836363 AraportID:AT5G62420 Length:316 Species:Arabidopsis thaliana


Alignment Length:288 Identity:110/288 - (38%)
Similarity:170/288 - (59%) Gaps:24/288 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTHIQGIGLGTFASTEGDCE---RAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKRE 75
            |..|..:|:||:. .:.|.|   .||..||.:||||.|||..||:|..:|.|:.:.|:.|.::|:
plant    11 GETIPLLGMGTYC-PQKDRESTISAVHQAIKIGYRHFDTAKIYGSEEALGTALGQAISYGTVQRD 74

  Fly    76 DIFITTKLW-CNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVEL 139
            |:|:|:||| .:.|:|..   |..:|||.:||||:|.||:|||...| .|.:|.|||:...|   
plant    75 DLFVTSKLWSSDHHDPIS---ALIQTLKTMGLDYLDNYLVHWPIKLK-PGVSEPIPKEDEFE--- 132

  Fly   140 VDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIALC 204
            .|:...:||..||:.:::||.:|||||||:.:::..||....:.|..||:|:||...|:||..:|
plant   133 KDLGIEETWQGMERCLEMGLCRSIGVSNFSSKKIFDLLDFASVSPSVNQVEMHPLWRQRKLRKVC 197

  Fly   205 KKNGILVTAFSPLG------RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLP 263
            ::|.|.|:.:||||      ...|.:..|.      :::||.|:|.:.|||.:|:.:..|...:.
plant   198 EENNIHVSGYSPLGGPGNCWGSTAVIEHPI------IKSIALKHNATPAQVALRWGMSKGASVIV 256

  Fly   264 KSSNPKRIEENFNVFDFKLDAEDHAILD 291
            ||.|..|:.||....:.|||.:|.:::|
plant   257 KSFNGARMIENKRALEIKLDDQDLSLID 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 110/288 (38%)
Tas 12..299 CDD:223739 110/288 (38%)
AT5G62420NP_201048.1 AKR_AKR4A_4B 10..288 CDD:381350 110/288 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.