DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AKR1E2

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_011518017.1 Gene:AKR1E2 / 83592 HGNCID:23437 Length:341 Species:Homo sapiens


Alignment Length:308 Identity:137/308 - (44%)
Similarity:178/308 - (57%) Gaps:22/308 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDIFITTKLWCNFHEPE 91
            ::.|....||..|||.||||.|.||||.||.||||.:|.||.||.::|||:||.|||||..|:..
Human    35 ASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKS 99

  Fly    92 RVEYACRKTLKNIGLDYVDLYLIHWPFSYK------YRGDNEL-----------IPKDANGEVEL 139
            .||.||||:||.:.|:|:||||||||..:|      ....:||           :|.|.:..|..
Human   100 LVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIP 164

  Fly   140 VDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLIA 202
            .|.|:||||.|||.||..||.|:|||||||.|||.|||  ...:.||:.||||.||.|.||.||:
Human   165 SDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLIS 229

  Fly   203 LCKKNGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSN 267
            .|:...:.|||:.|||   ........:.:..::.||.::.||.||::||:.|:...|.:|.|..
Human   230 FCQSRDVSVTAYRPLG---GSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSIT 291

  Fly   268 PKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFNV 315
            |..|:||..||||:|...|...:.|.:...|:|........|.|||::
Human   292 PSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 131/289 (45%)
Tas 12..299 CDD:223739 131/290 (45%)
AKR1E2XP_011518017.1 ARA1 34..322 CDD:223729 131/289 (45%)
Tas 42..314 CDD:223739 129/274 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.