DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AT5G01670

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_850750.1 Gene:AT5G01670 / 831701 AraportID:AT5G01670 Length:349 Species:Arabidopsis thaliana


Alignment Length:328 Identity:112/328 - (34%)
Similarity:169/328 - (51%) Gaps:37/328 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKHNDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIK 73
            |:...|..|..:||||:.|........|...::.||||||||:.||::.|||..:::.:..| ::
plant    16 FRLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEYGDQREVGQGIKRAMHAG-LE 79

  Fly    74 REDIFITTKLW---------------------------CNFHEPERVEYACRKTLKNIGLDYVDL 111
            |.|:|:|:|||                           |....||||..|.:.|||.:.|:|:||
plant    80 RRDLFVTSKLWYTLILRKMINLSSPLMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLDL 144

  Fly   112 YLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRL 176
            ||||||.  :.|......||..    :::|.|....|..||.|....|.::|||.||...:|.:|
plant   145 YLIHWPI--RLREGASKPPKAG----DVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKL 203

  Fly   177 LANCKIKPIHNQIEVHPALDQKKLIALCKKNGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADK 241
            |...::.|...|:|:||.....:::..||||.|.|||:||||....   ....::|..|..||.|
plant   204 LGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEG---GRDLIHDQTVDRIAKK 265

  Fly   242 YNKSIAQVVIRYVIELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAI 306
            .||:..|:::::.::.||..:|||.||:||:||..|||:.:..:|...|:|..:.:||.......
plant   266 LNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVIDGEDLF 330

  Fly   307 KSK 309
            .:|
plant   331 VNK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 109/315 (35%)
Tas 12..299 CDD:223739 108/313 (35%)
AT5G01670NP_850750.1 ARA1 11..317 CDD:223729 108/310 (35%)
Tas 13..317 CDD:223739 108/310 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.