DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AKR4C10

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_181315.2 Gene:AKR4C10 / 818356 AraportID:AT2G37790 Length:314 Species:Arabidopsis thaliana


Alignment Length:275 Identity:112/275 - (40%)
Similarity:170/275 - (61%) Gaps:7/275 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YFKHNDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVI 72
            :|:.|.|..|..:||||:.:..|....||..|:.:||||||.|..||||.|:|..::|....||:
plant     7 FFELNTGAKIPSVGLGTWQADPGLVGNAVDAAVKIGYRHIDCAQIYGNEKEIGLVLKKLFDGGVV 71

  Fly    73 KREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEV 137
            |||::|||:||||.:|:|:.|..|..:||:::.||||||||||||.|.| :|.....|::     
plant    72 KREEMFITSKLWCTYHDPQEVPEALNRTLQDLQLDYVDLYLIHWPVSLK-KGSTGFKPEN----- 130

  Fly   138 ELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIA 202
             ::..|...||.|||.|.|.|..::||||||:.::|..||...::.|..||:|.||:..|..|..
plant   131 -ILPTDIPSTWKAMESLFDSGKARAIGVSNFSSKKLADLLVVARVPPAVNQVECHPSWQQNVLRD 194

  Fly   203 LCKKNGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSN 267
            .||..|:.::.:||||.......|...:.:..:..:|:|..|:.|||.:|:.:::|...||||::
plant   195 FCKSKGVHLSGYSPLGSPGTTWLTSDVLKNPILGGVAEKLGKTPAQVALRWGLQMGQSVLPKSTH 259

  Fly   268 PKRIEENFNVFDFKL 282
            ..||::||:||::.:
plant   260 EDRIKQNFDVFNWSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 112/275 (41%)
Tas 12..299 CDD:223739 111/271 (41%)
AKR4C10NP_181315.2 AKR_AKR4C1-15 6..292 CDD:381351 112/275 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.