DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AKR4C8

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_565871.1 Gene:AKR4C8 / 818353 AraportID:AT2G37760 Length:311 Species:Arabidopsis thaliana


Alignment Length:276 Identity:118/276 - (42%)
Similarity:168/276 - (60%) Gaps:13/276 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YFKHNDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVI 72
            :|:.|.|..:..:||||:|..    ..|:..||.:||||||.|..||||.|:|..::|.|.:|.:
plant     7 FFELNTGAKLPCVGLGTYAMV----ATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGFV 67

  Fly    73 KREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEV 137
            |||::|||:|||.|.|.||.|..|..|||:::.:|||||||||||.|.|   ...|:|...    
plant    68 KREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASLK---KESLMPTPE---- 125

  Fly   138 ELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIA 202
            .|...|...||.|||.|.|.|..::||||||:.::||.||...::.|..||:|.||...|:.|..
plant   126 MLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHE 190

  Fly   203 LCKKNGILVTAFSPLG-RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSS 266
            |||..|:.::.:|||| :...|:|... :.:..|..:|:|..|:.|||.:|:.::.|...|||||
plant   191 LCKSKGVHLSGYSPLGSQSKGEVRLKV-LQNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSS 254

  Fly   267 NPKRIEENFNVFDFKL 282
            :..|::||.:|||:.:
plant   255 SGARLKENLDVFDWSI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 118/276 (43%)
Tas 12..299 CDD:223739 117/272 (43%)
AKR4C8NP_565871.1 AKR_AKR4C1-15 6..288 CDD:381351 118/276 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm2923
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.