DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c21

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_084177.2 Gene:Akr1c21 / 77337 MGIID:1924587 Length:323 Species:Mus musculus


Alignment Length:298 Identity:119/298 - (39%)
Similarity:171/298 - (57%) Gaps:15/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTEGDCERAVLH-----AIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGV 71
            |||..|..:|.||....|  |.::...     |||.|:.|.|:|..|..|..||.|:|.|||:|.
Mouse    11 NDGNFIPVLGFGTALPLE--CPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGT 73

  Fly    72 IKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGE 136
            ::|||||.|:|:||....||.|..:..::|:.:..|||||||||:|.:.|...:|  .|.|.:|:
Mouse    74 VRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEEN--FPVDEHGK 136

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKK 199
            :....:|...||.||||..|.||||||||||||..||..:|  ...|.||:.||:|.||.|:|.|
Mouse   137 LIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQMK 201

  Fly   200 LIALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTI 260
            |:..||...|::.|:..||...    .:..:|..:.:..:.::|.|||::.|.:.:||.::.|.:
Mouse   202 LLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSMAKKYNRTPALIALRYQLQRGIV 266

  Fly   261 PLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGER 298
            .|..|...:||:||..||:|:|.:||..:||..:...|
Mouse   267 VLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 118/296 (40%)
Tas 12..299 CDD:223739 119/298 (40%)
Akr1c21NP_084177.2 AKR_AKR1C1-35 6..308 CDD:381334 119/298 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.