DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c12

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_038805.2 Gene:Akr1c12 / 622402 MGIID:1351661 Length:323 Species:Mus musculus


Alignment Length:324 Identity:139/324 - (42%)
Similarity:187/324 - (57%) Gaps:14/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGKVEYYFKHNDGTHIQGIGLGTFASTE----GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGA 61
            |:.| ::|.|.|||..|..:|.||:...|    ...|.|.| |:||||||:||||.|..|.|:|.
Mouse     1 MSSK-QHYVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACL-ALDVGYRHVDTAYAYQVEEEIGQ 63

  Fly    62 AVRKKIAEGVIKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDN 126
            |::.||..||:||||:||||||||....||.|:.|..|:||::.||||||||||:|...| .|||
Mouse    64 AIQSKIKAGVVKREDLFITTKLWCGCFRPELVKPALEKSLKSLQLDYVDLYLIHYPVPMK-PGDN 127

  Fly   127 ELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQI 189
            | .|.|.||:..|..:|:.|||..:|:..|.||.|||||||||..||.|:|  ...|.||:.||:
Mouse   128 E-SPLDENGKFLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQV 191

  Fly   190 EVHPALDQKKLIALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVV 250
            |.|..|:|.||:..||...|::.|:..||...    .:..:|..:.|..:..:|.:..:|.|.:.
Mouse   192 ECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKRNKRSPALIA 256

  Fly   251 IRYVIELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            :||:.:.|.:||.:|.....:.||..||:|:|..||...||..:...|...|........|||:
Mouse   257 LRYLFQRGIVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLPAEFLADHPEYPFS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 132/302 (44%)
Tas 12..299 CDD:223739 130/296 (44%)
Akr1c12NP_038805.2 Tas 6..297 CDD:223739 130/293 (44%)
ARA1 7..307 CDD:223729 133/302 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.