DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1a1

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_067448.1 Gene:Akr1a1 / 58810 MGIID:1929955 Length:325 Species:Mus musculus


Alignment Length:314 Identity:133/314 - (42%)
Similarity:191/314 - (60%) Gaps:27/314 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEG-VIKREDIFITTKL 83
            |||||:.|..|..:.|:.||:..||||||.|..||||.|:|.|:::.:..| .:.||::|:|:||
Mouse    17 IGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPREELFVTSKL 81

  Fly    84 WCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTW 148
            |...|.||.||.|.||||.::.|:|:||||:|||:::: ||||. .||:|:|.|......|.:||
Mouse    82 WNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFE-RGDNP-FPKNADGTVRYDSTHYKETW 144

  Fly   149 GAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIALCKKNGILVTA 213
            .|:|.||..||.|::|:||||..|:..:|:...::|...|:|.||.|.|.:|||.|...|:.|||
Mouse   145 KALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTA 209

  Fly   214 FSPLG------RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRIE 272
            :||||      ||..|   |..:.:..|.|:|:|:.:|.||:::|:.::...|.:|||.||.||.
Mouse   210 YSPLGSSDRAWRHPDE---PVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSINPSRIL 271

  Fly   273 ENFNVFDFKLDAEDHAILDSYH------------NGERVAHARQAIKSKYYPFN 314
            :|..||||....|:...||:.:            :|:||  .|.| ....||||
Mouse   272 QNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRV--PRDA-GHPLYPFN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 125/296 (42%)
Tas 12..299 CDD:223739 125/297 (42%)
Akr1a1NP_067448.1 ARA1 1..303 CDD:223729 124/290 (43%)
Tas 9..291 CDD:223739 123/278 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.