DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and zgc:110782

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001013503.1 Gene:zgc:110782 / 541358 ZFINID:ZDB-GENE-050320-51 Length:287 Species:Danio rerio


Alignment Length:287 Identity:104/287 - (36%)
Similarity:160/287 - (55%) Gaps:22/287 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTHIQGIGLGTFASTEGD-CERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDI 77
            ||.:..:||||:...:.: .:::|..|:..|||..|||..|||||.:|..:::.:.:..:.|||:
Zfish    11 GTQMPLLGLGTYKLQDHEQLKQSVSCALQAGYRAFDTAAVYGNEAHLGQVLKELLPKYGLIREDV 75

  Fly    78 FITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDI 142
            ||.:||..:.| ..|.:..|.::|:.:..:|:||||||||      |...|.|:|:...      
Zfish    76 FIISKLAPSDH-GLRAKEGCLRSLEQLDCEYIDLYLIHWP------GMEGLDPEDSRHS------ 127

  Fly   143 DY-LDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIALCKK 206
            :| ..:|..:|:....|..|:|||||:..:.:..|||:|::.|...|||..|.|.|::|..||.:
Zfish   128 EYRAQSWATLEEFHASGQFKAIGVSNYTAKHIRELLASCRVPPAVLQIECQPKLIQRELRDLCME 192

  Fly   207 NGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRI 271
            .||...|:|.||: .|.||.|      :|..|.....::.|||::|:.::.|...||:||.|.|:
Zfish   193 TGIHFQAYSSLGK-GALLREP------EVMDIVRHCGRTPAQVLLRWALQQGISVLPRSSQPSRV 250

  Fly   272 EENFNVFDFKLDAEDHAILDSYHNGER 298
            .||..||||||:..|...||..:.|.|
Zfish   251 LENAQVFDFKLNETDMKRLDDLNCGTR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 103/285 (36%)
Tas 12..299 CDD:223739 104/287 (36%)
zgc:110782NP_001013503.1 ARA1 1..280 CDD:223729 104/287 (36%)
Tas 17..271 CDD:223739 99/273 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.