DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and RGD1564865

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001157868.1 Gene:RGD1564865 / 498789 RGDID:1564865 Length:323 Species:Rattus norvegicus


Alignment Length:313 Identity:131/313 - (41%)
Similarity:184/313 - (58%) Gaps:13/313 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTEGDCERAVLH----AIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVI 72
            :||..:..:|.|||.:.|....: :|.    |||:|:||||:||.|.||.|||.|:|.||..||:
  Rat    11 SDGRLMPLLGYGTFQNPEIPASK-ILESTKIAIDIGFRHIDSAYVYKNEKEVGEAIRSKITGGVV 74

  Fly    73 KREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEV 137
            ||||||:|||||..||.||.|.....::||:..||||||||||:|.|.|  ...|:..||.||::
  Rat    75 KREDIFLTTKLWSTFHRPELVRVGLERSLKSFQLDYVDLYLIHYPISIK--PSEEIYTKDENGKI 137

  Fly   138 ELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKL 200
            ....:|....|.||||..|.||.|||||||||..||..:|  ...|.:|:.||:|.||.|:|.||
  Rat   138 LFETVDLCAIWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKHRPVCNQVECHPYLNQSKL 202

  Fly   201 IALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIP 261
            :..||...|::.|::.||...    .:...|..:.|..:..:|.|:|:|.||:.:||.::.|.:.
  Rat   203 MDFCKSQDIVLVAYAALGSQRPTNWVDKNAPFLLNDPVLGGMAKKHNRSPAQIALRYQVQRGVVA 267

  Fly   262 LPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            |.::...|.::||..||:|:|.:||..:||..:...|......|.:...||::
  Rat   268 LAQTYEQKEMKENIQVFEFQLPSEDMEVLDGLNRNFRYFPVNIAAEHPNYPYS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 127/295 (43%)
Tas 12..299 CDD:223739 127/296 (43%)
RGD1564865NP_001157868.1 ARA1 8..311 CDD:223729 128/302 (42%)
Tas 19..297 CDD:223739 123/280 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.