DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and akr1b1

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001011130.1 Gene:akr1b1 / 496546 XenbaseID:XB-GENE-5821742 Length:318 Species:Xenopus tropicalis


Alignment Length:313 Identity:154/313 - (49%)
Similarity:203/313 - (64%) Gaps:15/313 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 THIQ---G-----IGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGV 71
            ||:|   |     :||||:.|..|....||..||:|||||:|.||.|.||.|||..:::||.||:
 Frog     5 THVQLYTGAQMPIVGLGTWKSEPGKVTAAVAKAIEVGYRHLDCAYVYQNENEVGEGIQQKIKEGL 69

  Fly    72 IKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGE 136
            :||||:|:.:|||..||:...|:.||:|||.::.|||:||||:|||..:: .|| .|.|.|..|.
 Frog    70 VKREDLFVVSKLWSTFHDKSMVKGACQKTLSDLKLDYLDLYLVHWPTGFQ-AGD-ALFPLDNEGC 132

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKK 199
            |...:..:||||..||:|||.||.|:||:||||.||:.:||  ...|.||..:|.|.||.|.|||
 Frog   133 VIHSNTHFLDTWEGMEELVDAGLVKAIGISNFNREQIEQLLNKPGLKHKPAVHQFECHPYLTQKK 197

  Fly   200 LIALCKKNGILVTAFSPLG---RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIP 261
            ||.||:..||:|||:||||   |..|:...|:.:.:.|::.||.||||:.|||:||:.|:...:.
 Frog   198 LIDLCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEEPKIKEIAKKYNKTSAQVLIRFHIQRNVVV 262

  Fly   262 LPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            :|||..|.||||||.||||:|..||...:.|:..|.||.....|.|.|.|||:
 Frog   263 IPKSVTPARIEENFQVFDFELSPEDTEAIFSFERGWRVCALSSAKKHKDYPFH 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 146/295 (49%)
Tas 12..299 CDD:223739 146/296 (49%)
akr1b1NP_001011130.1 AKR_AKR1B1-19 12..318 CDD:381333 151/306 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.