DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and zgc:101765

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001006056.1 Gene:zgc:101765 / 450036 ZFINID:ZDB-GENE-041010-156 Length:288 Species:Danio rerio


Alignment Length:289 Identity:103/289 - (35%)
Similarity:154/289 - (53%) Gaps:22/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTF-ASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKRE 75
            |:...:..:||||| ...:.|...||..|:..|||..|||..|.|||.:|.|:|..:.:..:.||
Zfish    11 NNDIQMPLLGLGTFRLQGQEDTYSAVDAALKAGYRAFDTAAVYRNEAHLGHALRCLLPKHGLSRE 75

  Fly    76 DIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNEL-IPKDANGEVEL 139
            |:|||:||... .:..:....|:|:|:.:||.|:||||||||      |...| :....|.|   
Zfish    76 DVFITSKLGPK-DQGSKARNGCQKSLEQLGLGYIDLYLIHWP------GTQGLPVGDKRNPE--- 130

  Fly   140 VDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIALC 204
               :...:|..:|:....|..::|||||:..|.:..||.:||:.|...|:|.||.|.|..|..||
Zfish   131 ---NRAQSWRVLEEFYSEGKFRAIGVSNYTVEHMQELLKSCKVPPAVLQVEFHPKLLQNDLRGLC 192

  Fly   205 KKNGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPK 269
            |..|:...|:|.||       |...:.:..|..||.:..::.|||::|:.::.....|||||.|:
Zfish   193 KIRGVCFQAYSSLG-------TGLLLSNPVVLEIAKECGRTPAQVLLRWAVQQSIAVLPKSSQPE 250

  Fly   270 RIEENFNVFDFKLDAEDHAILDSYHNGER 298
            |::||..:|||::..||...|.:...||:
Zfish   251 RVKENGRLFDFEISEEDMERLSALDCGEK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 102/287 (36%)
Tas 12..299 CDD:223739 103/289 (36%)
zgc:101765NP_001006056.1 ARA1 5..283 CDD:223729 103/289 (36%)
Tas 11..271 CDD:223739 100/279 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.670

Return to query results.
Submit another query.