DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AKR1B15

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:294 Identity:135/294 - (45%)
Similarity:180/294 - (61%) Gaps:7/294 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDIFITTKLWCNFHEP 90
            ||..|..:.||..|||..|||||.||||.|:.|||.|:::||.|..:.|||:||.:|:|..|.|.
Human    50 ASLLGKVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMREDLFIVSKVWPTFFER 114

  Fly    91 ERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTWGAMEKLV 155
            ..|..|..||||::.|.|:|:||||||..:| .|| :..|||..|.:......:||.|.|||:||
Human   115 PLVRKAFEKTLKDLKLSYLDVYLIHWPQGFK-TGD-DFFPKDDKGNMISGKGTFLDAWEAMEELV 177

  Fly   156 DLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLIALCKKNGILVTAFSPLG 218
            |.||.|::||||||..|:.|||  ...|.||:.||:|.||.|.|:|||..|...||.|||:||||
Human   178 DEGLVKALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLG 242

  Fly   219 ---RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRIEENFNVFDF 280
               |..|:...|:.:.|.|::.||.|:.|:.|||:||:.|:.....:|||..|..|.||..||||
Human   243 SPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQVFDF 307

  Fly   281 KLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            ||..|:.|.:.|::...|....::....:.:||:
Human   308 KLSDEEMATILSFNRNWRAFDFKEFSHLEDFPFD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 132/276 (48%)
Tas 12..299 CDD:223739 132/277 (48%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 129/270 (48%)
Tas 57..317 CDD:223739 128/261 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158436
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.