DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c19

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001013807.2 Gene:Akr1c19 / 432720 MGIID:2653678 Length:323 Species:Mus musculus


Alignment Length:314 Identity:135/314 - (42%)
Similarity:183/314 - (58%) Gaps:11/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KHNDGTHIQGIGLGTFASTEGDCER---AVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGV 71
            |.|||..|..:|.||:...|.:..:   |:..|::.|:|||||||.|..|..||.|:|.|||.|:
Mouse     9 KLNDGNFIPALGFGTYKPEEVNENKPLEAIHLALEAGFRHIDTAYVYQTENHVGQAIRSKIAAGL 73

  Fly    72 IKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGE 136
            :||||||:||||||.||.||.|.....|:|||:.|||.||||||:|...|  ...:|.|:|.:|:
Mouse    74 VKREDIFLTTKLWCTFHRPELVRSNLEKSLKNLQLDYADLYLIHYPVQMK--PGEDLFPEDEHGK 136

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKK 199
            .....:|...||.||||..|.||.|||||||||..||.::|  ...|.||:.||:|.|..|:|:|
Mouse   137 TLFDTVDICATWEAMEKCKDAGLVKSIGVSNFNSRQLEKILNKPGLKYKPVCNQVECHLYLNQRK 201

  Fly   200 LIALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTI 260
            |:..||...|::.|:..||...    .:..:|..:.|..:..:|.|:.:|.||:.:||.::.|.:
Mouse   202 LLNYCKSKDIVLVAYCALGSQRPKRWVDPSSPVLLNDPILCDMAKKHKRSPAQIALRYHLQRGIV 266

  Fly   261 PLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            .|.:|.....|:||..||:|:|.:||..||||.....|.|.|........|||:
Mouse   267 VLAQSYKENEIKENIQVFEFELPSEDMKILDSLDRNLRYAPAPFGEGHPEYPFS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 129/296 (44%)
Tas 12..299 CDD:223739 128/295 (43%)
Akr1c19NP_001013807.2 ARA1 8..307 CDD:223729 130/299 (43%)
Tas 11..310 CDD:223739 131/300 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134145
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.