DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and CG3397

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster


Alignment Length:355 Identity:81/355 - (22%)
Similarity:140/355 - (39%) Gaps:93/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVEYYFKHNDGTHIQGIGLG-----TFASTEGDCERAVL---HAIDVGYRHIDTAYFYG---NEA 57
            ::||....:.|..:..|.||     ...|.:.|.|..:|   .||..|..:||||.|||   :|.
  Fly    21 RMEYRQLGSTGLRVSKIALGGATLSKLFSDDFDREEGILTVQEAIRSGINYIDTAPFYGQGKSEE 85

  Fly    58 EVGAAVRKKIAEGVIKREDIFITTKLWCNFHEPERV-EY-------ACRKTLKNIGLDYVDLYLI 114
            .:|.|::.      :.||..:|.||:.....:|..: :|       :.:::|:.:.||.||:..:
  Fly    86 LLGQALKD------VPREAYYIATKVARYELDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQV 144

  Fly   115 HWPFSYKYRGDNELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLAN 179
            |         |.:..|.        :|:...:|...:|:.|..|..:.|||:.::.:    :|..
  Fly   145 H---------DVDAAPS--------LDMVLNETIPVLEEYVQAGKARFIGVTAYDVD----VLKE 188

  Fly   180 C------KIKPIHNQIEVHPALDQKKL--------------IALCKKNGILVTAFSPLGRHNAEL 224
            |      :|:.:.|... :..||...|              .|.....|:|..| .|...|..  
  Fly   189 CAERGKGRIQVVLNYAR-YTLLDNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNA-GPQSWHPG-- 249

  Fly   225 RTPTFMYDGKVQA-IADKYNKSIAQVVIRYVIELG-----TIPLPKSSNPKRIEENFNVFDFKLD 283
             :|..:..||..| |..|.|..:.::.:.|.::|.     .|.:|   |.|.:..|.:       
  Fly   250 -SPELLAVGKRGAEICQKRNVELGKLAMYYTMQLDGAATFLIGIP---NRKLLRINLD------- 303

  Fly   284 AEDHAILD--SYHNGERVAHARQAIKSKYY 311
                ||.|  :.|..|.:.:.|:.:.:|.|
  Fly   304 ----AIFDGLTSHEQEVLQYLRENVFTKSY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 77/339 (23%)
Tas 12..299 CDD:223739 76/333 (23%)
CG3397NP_650140.1 Tas 22..304 CDD:223739 73/327 (22%)
Aldo_ket_red 24..322 CDD:294321 77/343 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.