DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and CG18547

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster


Alignment Length:336 Identity:80/336 - (23%)
Similarity:124/336 - (36%) Gaps:118/336 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVEYYFKHNDGTHIQGI--GLGTFASTEG-DCE---RAVLHAIDVGYRHIDTAYFYG---NEAEV 59
            ::||......|..:..:  |.|...:..| |.|   :.|..|:..|..:||||.:||   :|..:
  Fly    21 RMEYRNLGKTGLQVSKVSFGGGALCANYGFDLEEGIKTVHEAVKSGINYIDTAPWYGQGRSEEVL 85

  Fly    60 GAAVRKKIAEGVIKREDIFITTKL---------WCNFHEPERVEYACRKTLKNIGLDYVDLYLIH 115
            |.|::.      :.||..:|.||:         ..:| ..::...:..|:||.:||||||:..||
  Fly    86 GLALKD------VPRESYYIATKVARYELDYDKMFDF-SAKKTRESVEKSLKLLGLDYVDVIQIH 143

  Fly   116 WPFSYKYRGDNELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFN----EEQLTR- 175
                     |.| ..||       :||...:|...:|:||..|..:.||||.:.    :|.||| 
  Fly   144 ---------DIE-FAKD-------LDIVINETLPTLEQLVKEGKARFIGVSAYPISVLKEFLTRT 191

  Fly   176 -------------------------------------------LLANCKIKPIHNQIEVHPALDQ 197
                                                       ||.|...:|      .|||.|:
  Fly   192 AGRLDTVLTYARYTLTDETLLEYLDFFKSQNLGVICAAAHALGLLTNAGPQP------WHPASDE 250

  Fly   198 KKLIA-----LCKKNGILVTAFSPLGRHNAELRTPTFM------------YDGKVQAIADKYNKS 245
            :|.||     :||:.|:.:...:.....:......||:            .|.....::||    
  Fly   251 QKAIARKASEVCKERGVELGKLAMYYTMSGLPEVSTFLTGMQTRQLLRINLDANEVGLSDK---- 311

  Fly   246 IAQVVIRYVIE 256
             .|.|:||:.|
  Fly   312 -EQEVLRYLKE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 80/335 (24%)
Tas 12..299 CDD:223739 78/328 (24%)
CG18547NP_650138.1 Tas 22..331 CDD:223739 80/335 (24%)
Aldo_ket_red 24..321 CDD:294321 78/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.