DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and CG10638

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster


Alignment Length:308 Identity:181/308 - (58%)
Similarity:232/308 - (75%) Gaps:2/308 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KHNDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKR 74
            |.|:|..:..:||||:.|.:.:.|.||.||||||||||||||||.||||||.|:|.||||||:||
  Fly     8 KLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKR 72

  Fly    75 EDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVEL 139
            ||||:.||||..||:|||||..|||.|.|.||||:||||:|.|..|||..||.|:||:.:..::|
  Fly    73 EDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQL 137

  Fly   140 VDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIALC 204
            .|:|||||:.||||||.|||.:||||||||.|||.|:||||:|||:.||:|..|||:||.|.|.|
  Fly   138 SDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKALTAFC 202

  Fly   205 KKNGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPK 269
            |||.:.:|.::|||:...:::.|.|:|..:|..||.||.|:..|:|:||::.||.||:|||||..
  Fly   203 KKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSSNTN 267

  Fly   270 RIEENFNVFDFKLDAEDHAILDSYHNGERVA--HARQAIKSKYYPFNV 315
            ||.|||::|||:|.||:.|:||.||.||||.  :..:.:..|||||::
  Fly   268 RISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 173/287 (60%)
Tas 12..299 CDD:223739 173/286 (60%)
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 176/293 (60%)
Tas 5..297 CDD:223739 174/288 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472960
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Homologene 1 1.000 - - H134145
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm51343
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1211.800

Return to query results.
Submit another query.