DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c12

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c12 / 364773 RGDID:1359406 Length:323 Species:Rattus norvegicus


Alignment Length:324 Identity:136/324 - (41%)
Similarity:181/324 - (55%) Gaps:14/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGKVEYYFKHNDGTHIQGIGLGTFASTE----GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGA 61
            |:.|: :..|.|||..|..:|.||:...|    ...|.|.| ||||||||||||..|..|.|:|.
  Rat     1 MSSKL-HCVKLNDGHFIPALGFGTYKPKEVPKSKSLEAAHL-AIDVGYRHIDTASAYQVEEEIGQ 63

  Fly    62 AVRKKIAEGVIKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDN 126
            |::.||..||:||:|:||||||||:....|.|..|..|:|||:.||||||:|||:|...|...|.
  Rat    64 AIQSKIKAGVVKRKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVPIKSSVDE 128

  Fly   127 ELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQI 189
            .  |.|..|:..|..:|:.|||..:||..|.||.|||||||||.:||.|||  ...|.||:.||:
  Rat   129 S--PLDEKGKFLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQV 191

  Fly   190 EVHPALDQKKLIALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVV 250
            |.|..|:|.||:..||...|::.|:..||...    .:..:|..:.|..:..:|.|..:|.|.:.
  Rat   192 ECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPILCDVAKKNKRSPALIA 256

  Fly   251 IRYVIELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            :||:.:.|.:||.:|.....:.||..||:|:|..||...||..:...|...|........|||:
  Rat   257 LRYLFQRGVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLADHPEYPFS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 129/302 (43%)
Tas 12..299 CDD:223739 128/296 (43%)
Akr1c12NP_001014262.3 ARA1 8..305 CDD:223729 129/299 (43%)
Tas 16..297 CDD:223739 123/283 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.