DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c15

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:313 Identity:146/313 - (46%)
Similarity:189/313 - (60%) Gaps:11/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KHNDGTHIQGIGLGTFASTE---GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGV 71
            |.|||..:..:|.|||||.|   .....|...|||||:||||.||||.||.|||.|:|.|:|:|.
  Rat    10 KLNDGNLMPVLGFGTFASKEIPKSKAAEATKVAIDVGFRHIDAAYFYQNEEEVGQALRDKMADGT 74

  Fly    72 IKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGE 136
            :||||:|.|||:|..|..||.|.....::||.:|||||||.:||.|.:.|  ...||:||||||:
  Rat    75 VKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCIIHIPIAMK--PGEELLPKDANGK 137

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKK 199
            .....:|..|||.|:||..|.||:|||||||||.:||..:|  ...|.||..||:|.||.|:|.|
  Rat   138 FIFDTVDIRDTWEALEKCKDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCNQVECHPYLNQSK 202

  Fly   200 LIALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTI 260
            |:..||...|::.|:|.||.|.    ....:|..:.|..:..||.|:|::..||.:||.::.|.:
  Rat   203 LLEFCKSKDIVLVAYSALGSHRDSSWVSSDSPYLLEDPVLMTIAKKHNQTPGQVALRYQLQRGVV 267

  Fly   261 PLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPF 313
            .|.||.|.|||:|||.||||:|..||...:||.:...|.:....|:....|||
  Rat   268 VLAKSFNEKRIKENFQVFDFELTPEDMKTIDSLNRNFRYSQMAFALDHPDYPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 141/296 (48%)
Tas 12..299 CDD:223739 140/295 (47%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 141/297 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.