DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c13

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_006254252.1 Gene:Akr1c13 / 361266 RGDID:1308232 Length:371 Species:Rattus norvegicus


Alignment Length:282 Identity:125/282 - (44%)
Similarity:166/282 - (58%) Gaps:8/282 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDIFITTKLWCNFHEPERVEYACRKTLKN 103
            |||.|||||||||.|..|.|:|.|::.||..||:||||:||||||||....||.|:.|..|:|||
  Rat    89 AIDAGYRHIDTAYAYQIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKN 153

  Fly   104 IGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNF 168
            :.|||.|||::|:|...| .|||: .|.|..|:..|..:|:.|||..:||..|.||.||||||||
  Rat   154 LQLDYADLYIMHYPVPMK-SGDND-FPVDEKGKSLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNF 216

  Fly   169 NEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLIALCKKNGILVTAFSPLGRHN----AELRTP 227
            |.:||.|||  ...|.||:.||:|.|..|:|.||:..||...|::.|:..||...    .:..:|
  Rat   217 NHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSP 281

  Fly   228 TFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDS 292
            ..:.|..:..:|.|..:|.|.:.:||:::.|.:||.:|.....:.||..||||:|..||...||.
  Rat   282 VLLNDPVLCDVAKKNKRSPALIALRYLVQRGVVPLAQSFKENEMRENLQVFDFQLSPEDMKTLDG 346

  Fly   293 YHNGERVAHARQAIKSKYYPFN 314
            .:...|...|........|||:
  Rat   347 LNKNFRYLSAEFLAGHPEYPFS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 120/264 (45%)
Tas 12..299 CDD:223739 120/265 (45%)
Akr1c13XP_006254252.1 Tas 77..345 CDD:223739 118/257 (46%)
ARA1 89..353 CDD:223729 120/265 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.