DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and gclm

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_009302077.1 Gene:gclm / 333974 ZFINID:ZDB-GENE-030131-5906 Length:274 Species:Danio rerio


Alignment Length:121 Identity:28/121 - (23%)
Similarity:54/121 - (44%) Gaps:17/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEV 137
            :||::.::.||:....:...:..|......::|:..:|..:|..|          .:|:   ||.
Zfish    84 EREELKVSVKLFLTEWDCSSIRSAVDMACLSLGVSQLDSVIIAPP----------SLPE---GES 135

  Fly   138 E-LVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANC-KIKPIHNQIEV 191
            : |..:..|  |..:|.||......:||.|:.::..|.:|.... :|||..||:.:
Zfish   136 QTLTHLQPL--WQELESLVQSQKIAAIGTSDLDKTLLEQLYNWAQQIKPSSNQVNL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 28/121 (23%)
Tas 12..299 CDD:223739 28/121 (23%)
gclmXP_009302077.1 Aldo_ket_red <85..255 CDD:294321 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.