DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and zgc:56622

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_005169977.1 Gene:zgc:56622 / 326033 ZFINID:ZDB-GENE-030131-4758 Length:324 Species:Danio rerio


Alignment Length:320 Identity:139/320 - (43%)
Similarity:184/320 - (57%) Gaps:16/320 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVEYYFKHNDGTHIQGIGLGTF--ASTEGD-CERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRK 65
            |:|.    ||||.:..:||||:  .||..| |:||...||..||||||||:.|.||.:||.|::.
Zfish    10 KIEL----NDGTFMPLLGLGTWKPESTGPDMCQRACEAAIAAGYRHIDTAFCYRNEVDVGMAIQN 70

  Fly    66 KIAEGVIKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIP 130
            ||.:|:|:|:|:||.:|||...|.||.:.....|:|.::.|||:|.||:|:|...|..|| ||.|
Zfish    71 KIQQGIIRRQDMFIVSKLWGTHHAPEDIPVCFNKSLSDLQLDYLDQYLVHFPVGLKKVGD-ELFP 134

  Fly   131 KDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPAL 195
             :.:|::...||||:|.|..||.|...|..||||||||..||:.|||:..||.|..||:|:||.|
Zfish   135 -ERDGKILTTDIDYVDVWRGMEALKATGKVKSIGVSNFTMEQIDRLLSVAKIPPAVNQVELHPYL 198

  Fly   196 DQKKLIALCKKNGILVTAFSPLGRHNAELRTPT-------FMYDGKVQAIADKYNKSIAQVVIRY 253
            .|..||..||...|.:||.||.|.....|...|       .:.|..|..:|.|:.::.|||::||
Zfish   199 VQSDLIDYCKSKNIALTAHSPFGSPGRPLEFQTGDKDPMGLLEDPVVVDVARKHRRTPAQVLLRY 263

  Fly   254 VIELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPF 313
            .|:.....:|||..|..|.||..:|||.||.||...|.|.:.|.|.....:.....:|||
Zfish   264 HIQQDIAVIPKSVKPHHILENTKIFDFTLDEEDMNALKSLNRGWRACIITELEAHYFYPF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 134/302 (44%)
Tas 12..299 CDD:223739 133/296 (45%)
zgc:56622XP_005169977.1 ARA1 10..308 CDD:223729 135/303 (45%)
Tas 22..300 CDD:223739 126/279 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.