DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c1

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001028869.1 Gene:Akr1c1 / 307092 RGDID:1306847 Length:323 Species:Rattus norvegicus


Alignment Length:302 Identity:136/302 - (45%)
Similarity:184/302 - (60%) Gaps:17/302 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTE---GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIK 73
            :||..|..:|.||:|..|   .....|...|||.|:||||:|..|.||.|||.|:|.|||:|.:|
  Rat    11 SDGHFIPVLGFGTYAPREVPKSKALEATKIAIDAGFRHIDSAAVYQNEKEVGLAIRSKIADGTVK 75

  Fly    74 REDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVE 138
            |||||.|:|:||.|:.||||:....::||.:.|:||||||||:|.:.|  .:.:|..||.|.::.
  Rat    76 REDIFYTSKVWCTFNHPERVQVCLEQSLKQLQLEYVDLYLIHFPMALK--PEEDLKAKDENEKLL 138

  Fly   139 LVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLI 201
            ...:|..|||.||||..|.||.|||||||||..||.::|  ...|.:|:.||:|.||.|:|:||:
  Rat   139 FDVVDICDTWKAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQVECHPYLNQRKLL 203

  Fly   202 ALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPL 262
            ..||...|::.|:|.||.|.    .:...|..:.|..:.|||.|||.:.|.:.:||.:|.|.:.|
  Rat   204 DFCKSKDIVLVAYSALGSHRETRCVDKSLPVLLADPVLCAIAKKYNWTPALIALRYQLERGVVVL 268

  Fly   263 PKSSNPKRIEENFNVFDFKLDAEDHAILDS------YHNGER 298
            .||...|||:||..||:|:|.:||..:||.      |.:|.|
  Rat   269 AKSFTEKRIKENMQVFEFQLTSEDMKVLDGLNKNIRYMSGSR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 135/300 (45%)
Tas 12..299 CDD:223739 136/302 (45%)
Akr1c1NP_001028869.1 ARA1 5..305 CDD:223729 133/295 (45%)
Tas 16..297 CDD:223739 129/282 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.