DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1e2

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001008343.1 Gene:Akr1e2 / 307091 RGDID:1309599 Length:301 Species:Rattus norvegicus


Alignment Length:303 Identity:146/303 - (48%)
Similarity:191/303 - (63%) Gaps:11/303 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDIFITT 81
            |..:||||:.::.|:...||..||::||||.|.||.|.||:|||..:::||.|||:||:::||.:
  Rat     4 IPTVGLGTWKASPGEVTDAVKVAINLGYRHFDCAYLYHNESEVGMGIKEKIKEGVVKRDELFIVS 68

  Fly    82 KLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLD 146
            ||||.:|:...|:.||..||:.:.|||:||||||||..:| .||.: ||.|.:|:|......:||
  Rat    69 KLWCTYHKQSLVKTACINTLEALNLDYLDLYLIHWPMGFK-PGDKD-IPLDRSGKVIPSHTSFLD 131

  Fly   147 TWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLIALCKKNGI 209
            ||.|||.||..||.|:|||||||.|||.|||  ...:||||.||||.||.|:||.||..|....:
  Rat   132 TWEAMEDLVIEGLVKNIGVSNFNHEQLDRLLNKPGLRIKPITNQIECHPYLNQKSLIDFCHGRNV 196

  Fly   210 LVTAFSPLG--RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRIE 272
            .|||:.|||  |....|     |.|..::.||.|:.||.||::||:.|:...|.:|||.||.||.
  Rat   197 SVTAYRPLGGSRDGVHL-----MDDIVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVNPSRIR 256

  Fly   273 ENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFNV 315
            ||..||||:|..:|...|.|.....|:|........|.|||::
  Rat   257 ENIQVFDFELTEKDMEELLSLDKNLRLATFPSTENHKDYPFHI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 140/284 (49%)
Tas 12..299 CDD:223739 140/285 (49%)
Akr1e2NP_001008343.1 Tas 4..287 CDD:223739 142/289 (49%)
ARA1 4..282 CDD:223729 140/284 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.