DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c2

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_006254245.1 Gene:Akr1c2 / 291283 RGDID:1311841 Length:323 Species:Rattus norvegicus


Alignment Length:298 Identity:125/298 - (41%)
Similarity:175/298 - (58%) Gaps:11/298 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KHNDGTHIQGIGLGTFASTE---GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGV 71
            |.|||..|..:|.||...:|   ...:.....|||.|:.|.|:|:.|..|..||.|:|:|||.|.
  Rat     9 KLNDGHFIPVLGFGTAMPSELPKSKAKEVTKIAIDAGFHHFDSAFVYNTEDHVGEAIREKIANGT 73

  Fly    72 IKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGE 136
            .:|||||.|:||||....||.|..:...:||.:.||||||||||:|.:.| .|| |..|.|.:|:
  Rat    74 TRREDIFYTSKLWCTSLHPELVRSSLECSLKKLQLDYVDLYLIHFPMALK-PGD-ENFPVDEHGK 136

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKK 199
            :....:|...||.||||..|.||.|||||||||..||.::|  ...|.||:.||:|.|..|:|.|
  Rat   137 LLFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVECHLYLNQMK 201

  Fly   200 LIALCKKNGILVTAFSPLG--RHN--AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTI 260
            |:..||.|||::.|:..||  |:|  .:..:|..:.:..:.::|.|||::.|.:.:|:.::.|.:
  Rat   202 LLDFCKTNGIILVAYGVLGTQRYNGWVDQNSPVLLNEPVLSSMAKKYNQTPALIALRHQLQRGIV 266

  Fly   261 PLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGER 298
            .|..|...:||:||..||:|:|..||..:||..:...|
  Rat   267 VLNTSLKEERIKENMKVFEFQLSPEDMKVLDDLNRNLR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 124/296 (42%)
Tas 12..299 CDD:223739 124/296 (42%)
Akr1c2XP_006254245.1 AKR_AKR1C1-35 6..308 CDD:381334 125/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.