DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1b8

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_775159.1 Gene:Akr1b8 / 286921 RGDID:708475 Length:316 Species:Rattus norvegicus


Alignment Length:300 Identity:134/300 - (44%)
Similarity:189/300 - (63%) Gaps:7/300 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDIFITTKLW 84
            :||||:.|.....:.||..|||.||||||.||.|.||.|||.|:::||.|..::|||:||.:|||
  Rat    16 VGLGTWKSMPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAVRREDLFIVSKLW 80

  Fly    85 CNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTWG 149
            ....|.:.::.|.:|||.::.|||:||||||||  ..::...||.|||..|.|......:|:.|.
  Rat    81 PTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWP--QGFQAGKELFPKDEQGNVLPSKTTFLEAWE 143

  Fly   150 AMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLIALCKKNGILVT 212
            .||:|||.||.|::||||||..|:.|||  ...|.||:.||:|.||.|.|:|||..|...||:||
  Rat   144 GMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIVVT 208

  Fly   213 AFSPLG---RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRIEEN 274
            |:||||   |..|:...|:.:.|.|::.||.|:.|:.|||:||:.|:...:.:|||..|.||:||
  Rat   209 AYSPLGSPDRPRAKPDDPSLLQDPKIKEIAAKHKKTTAQVLIRFHIQRNVVVIPKSVTPARIQEN 273

  Fly   275 FNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            ..||||:|..::.|.:.|::...|.....:.:..:.:|::
  Rat   274 IQVFDFQLSDQEMATILSFNRNWRACLLPETVNMEEFPYD 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 132/282 (47%)
Tas 12..299 CDD:223739 132/283 (47%)
Akr1b8NP_775159.1 ARA1 1..297 CDD:223729 132/282 (47%)
Tas 16..289 CDD:223739 131/274 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.