Sequence 1: | NP_647839.1 | Gene: | CG12766 / 38462 | FlyBaseID: | FBgn0035476 | Length: | 320 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016856545.1 | Gene: | GCLM / 2730 | HGNCID: | 4312 | Length: | 275 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 55/233 - (23%) |
---|---|---|---|
Similarity: | 88/233 - (37%) | Gaps: | 66/233 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 EAEVGAAVRKKIAEGVIKREDIFITTKLW---CNFHEPER--VEYACRKTLKNIGLDYVDLYLIH 115
Fly 116 WPFSYKYRGDNELIPKDANGEVELVDIDYLDT-WGAMEKLVDLGLTKSIGVSNFNEEQLTRLLAN 179
Fly 180 CKIKPIHNQIE-----VHPALDQKKLIALCKKNGI-LVTAFSP--LGRHNA---------ELRTP 227
Fly 228 TFMYDGK---------------VQAIADKYNKSIAQVV 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12766 | NP_647839.1 | ARA1 | 5..298 | CDD:223729 | 55/233 (24%) |
Tas | 12..299 | CDD:223739 | 55/233 (24%) | ||
GCLM | XP_016856545.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0656 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |