DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and GCLM

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_016856545.1 Gene:GCLM / 2730 HGNCID:4312 Length:275 Species:Homo sapiens


Alignment Length:233 Identity:55/233 - (23%)
Similarity:88/233 - (37%) Gaps:66/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EAEVGAAVRKKIAEGVIKREDIFITTKLW---CNFHEPER--VEYACRKTLKNIGLDYVDLYLIH 115
            |..|..||.|...:   :||::.::.||:   .|.....|  |:.||    ..:|:..:|..:|.
Human    71 ECTVSHAVEKINPD---EREEMKVSAKLFIVESNSSSSTRSAVDMAC----SVLGVAQLDSVIIA 128

  Fly   116 WPFSYKYRGDNELIPKDANGEVELVDIDYLDT-WGAMEKLVDLGLTKSIGVSNFNEEQLTRLLAN 179
            .|          .|....|     :.:::|.. |..:|.||......:||.|:.::.||.:|...
Human   129 SP----------PIEDGVN-----LSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQW 178

  Fly   180 CKIKPIHNQIE-----VHPALDQKKLIALCKKNGI-LVTAFSP--LGRHNA---------ELRTP 227
            .::||..||:.     |.|    ..|.|..|:..| |:|...|  .|.|:.         ...:|
Human   179 AQVKPNSNQVNLASCCVMP----PDLTAFAKQFDIQLLTHNDPKETGFHHVTQAGLEFLDSSNSP 239

  Fly   228 TFMYDGK---------------VQAIADKYNKSIAQVV 250
            |....|.               :|  .|||.:.:|.|:
Human   240 TSASQGAGILGMSHCAWTKGYFIQ--GDKYLEKVAHVI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 55/233 (24%)
Tas 12..299 CDD:223739 55/233 (24%)
GCLMXP_016856545.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.