DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and SPAC19G12.09

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_594424.1 Gene:SPAC19G12.09 / 2542483 PomBaseID:SPAC19G12.09 Length:284 Species:Schizosaccharomyces pombe


Alignment Length:274 Identity:85/274 - (31%)
Similarity:135/274 - (49%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GIGLGTFASTEGDCERAVL----HAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDIFI 79
            |:|...|...:|:..|.::    :|:..|:.|||.|..||||.|||.|::    |..:.|..:||
pombe    16 GVGTALFKKEKGEINRTIVDSVKNALAAGFIHIDCAEVYGNEEEVGVALK----EANVPRSKLFI 76

  Fly    80 TTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDY 144
            |:|:   .|..:.:..|..::|:.:|.||:||||:|.|..:..:                 .|..
pombe    77 TSKV---MHNVDNIPEALNESLRKLGTDYLDLYLLHSPIPFYEK-----------------KIPI 121

  Fly   145 LDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQ--KKLIALCKKN 207
            .:.|.|||..:..||..|:|||||....|..||....|.|..||||.||.:.:  |.|:..|:..
pombe   122 SEGWKAMETALGTGLVHSVGVSNFRIPDLEELLKTSTITPRVNQIEFHPQVYKAAKPLVEFCQSK 186

  Fly   208 GILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRIE 272
            ||:|..:.||.....:.:.|...:   .:::..||:.|..|:::::....|.||:..:|..:|::
pombe   187 GIIVEGYGPLSPLVRDAQGPVAEF---TKSLESKYHVSDTQILLKWAYSKGVIPITTTSKIERMK 248

  Fly   273 ENFNVFDFKLDAED 286
            |..|...|.||..|
pombe   249 ECLNFDSFTLDKAD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 85/274 (31%)
Tas 12..299 CDD:223739 85/274 (31%)
SPAC19G12.09NP_594424.1 ARA1 10..279 CDD:223729 85/274 (31%)
Tas 12..266 CDD:223739 85/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.