DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and SPAP32A8.02

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_594178.1 Gene:SPAP32A8.02 / 2541584 PomBaseID:SPAP32A8.02 Length:283 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:102/289 - (35%)
Similarity:148/289 - (51%) Gaps:34/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKREDI 77
            :|..|..||.|.|.....:|...|..|:|.||||||||..||||...|.|:.....:..:||.||
pombe    15 NGMVIPRIGFGAFMLKYNECYGLVTQALDSGYRHIDTAAVYGNEDICGKAIVDWCEKNNVKRTDI 79

  Fly    78 FITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDI 142
            |:|:|| .|..:......|.|.:|.::| .|:||:||..|               |.|:...:  
pombe    80 FLTSKL-ANCSDYYSTRAAIRSSLHHLG-TYIDLFLIQSP---------------AGGKKSRI-- 125

  Fly   143 DYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLA-NCKIKPIHNQIEVHPALDQKKLIALCKK 206
               .:|.|||:.||.|..:|:||||:..:.|..|.| |.|..|..||||:||.|.|..::..|:.
pombe   126 ---ASWKAMEEFVDSGDIRSVGVSNYGVKHLQELYASNPKFYPCVNQIELHPFLSQDDIVKYCQS 187

  Fly   207 NGILVTAFSPLGRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSSNPKRI 271
            :.|.:.|:||| .|...|.      |.|:..||.|.|.|:||::||:.::.|.||:.||:..:.:
pombe   188 HDIAIEAYSPL-THGIRLN------DEKLVPIAKKLNISVAQLLIRWSLQKGYIPIIKSTKKEHM 245

  Fly   272 EENFNVFDFKLDAEDHAILDSY----HNG 296
            ..:.:||:|.:..:....|.|:    |.|
pombe   246 LSDLDVFNFTIPDDVVQELSSFDEHWHAG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 102/289 (35%)
Tas 12..299 CDD:223739 102/289 (35%)
SPAP32A8.02NP_594178.1 ARA1 6..283 CDD:223729 102/289 (35%)
Tas 16..279 CDD:223739 102/288 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.