DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AKR1B1

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001619.1 Gene:AKR1B1 / 231 HGNCID:381 Length:316 Species:Homo sapiens


Alignment Length:308 Identity:150/308 - (48%)
Similarity:201/308 - (65%) Gaps:7/308 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKRED 76
            |:|..:..:||||:.|..|....||..||||||||||.|:.|.||.|||.|:::|:.|.|:|||:
Human     8 NNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREE 72

  Fly    77 IFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVD 141
            :||.:||||.:||...|:.||:|||.::.|||:||||||||..:|  ...|..|.|.:|.|...|
Human    73 LFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFK--PGKEFFPLDESGNVVPSD 135

  Fly   142 IDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLIALC 204
            .:.||||.|||:|||.||.|:||:||||..|:..:|  ...|.||..||||.||.|.|:|||..|
Human   136 TNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC 200

  Fly   205 KKNGILVTAFSPLG---RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSS 266
            :..||:|||:||||   |..|:...|:.:.|.:::|||.|:||:.|||:||:.::...:.:|||.
Human   201 QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSV 265

  Fly   267 NPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            .|:||.|||.||||:|.::|...|.||:...||.........|.|||:
Human   266 TPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 144/290 (50%)
Tas 12..299 CDD:223739 144/291 (49%)
AKR1B1NP_001619.1 AKR_AKR1B1-19 10..316 CDD:381333 149/306 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.