DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and C56G3.2

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001367459.1 Gene:C56G3.2 / 183870 WormBaseID:WBGene00016985 Length:131 Species:Caenorhabditis elegans


Alignment Length:90 Identity:31/90 - (34%)
Similarity:48/90 - (53%) Gaps:12/90 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 WCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTW 148
            |.|...|.|:|.|.|.:||.:.|:||||||.|.|.::     ::.:.:.....||       |.|
 Worm    53 WTNELAPGRLEGALRDSLKKLHLEYVDLYLAHMPTAF-----SDDMSQKIESSVE-------DIW 105

  Fly   149 GAMEKLVDLGLTKSIGVSNFNEEQL 173
            ...:.:...||.|::||||:|.:|:
 Worm   106 RQFDAVYKAGLAKAVGVSNWNNDQI 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 31/90 (34%)
Tas 12..299 CDD:223739 31/90 (34%)
C56G3.2NP_001367459.1 AKR_SF <51..>131 CDD:412396 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.