DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Y39G8B.2

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_496926.1 Gene:Y39G8B.2 / 175048 WormBaseID:WBGene00012723 Length:339 Species:Caenorhabditis elegans


Alignment Length:284 Identity:100/284 - (35%)
Similarity:165/284 - (58%) Gaps:7/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKRED 76
            |.|..:..||.||:...:......|..|::.||||||:|..:.|:.||.|.::.......::||:
 Worm    10 NSGYEMPVIGYGTWQLPKNLAAERVRDALEAGYRHIDSALSFKNQEEVAAGIKDWCKIRKVRREE 74

  Fly    77 IFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSY---KYRGDNELIPKDANGEVE 138
            :|:::|:|..:|...|......:.|:.....|:||.:|||||.:   :..|:..|.|:.|||::.
 Worm    75 LFLSSKIWNTYHSRNRCMQQIDEMLEIFETTYMDLIVIHWPFGWAEDEPPGERGLWPRGANGKMR 139

  Fly   139 LVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLIAL 203
            ..|:|||:||.|:|.....|..:|||::|||..|:.::.....|||...|:|::|.|||:::...
 Worm   140 YSDVDYLETWKALEDAHRSGKIRSIGLANFNIGQVEQVWTKGLIKPAVLQVEMNPFLDQEEIRQF 204

  Fly   204 CKKNGILVTAFSPLGRHNAEL----RTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPK 264
            |::.||::|||...|...:.|    ..|..:|:..:|:||..:.||:.||::|:.|:|.|..|.|
 Worm   205 CREKGIILTAFMLTGNPGSALYRKHEDPNLLYNETLQSIAKGHGKSVVQVLVRWAIDLRTTALVK 269

  Fly   265 SSNPKRIEENFNVFDFKLDAEDHA 288
            ||..|||.:|.|:|.|:|.:::.|
 Worm   270 SSESKRIRQNINIFKFRLTSQEIA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 100/284 (35%)
Tas 12..299 CDD:223739 100/284 (35%)
Y39G8B.2NP_496926.1 AKR_AKR1-5-like 15..295 CDD:381297 98/279 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.