DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AKR1C2

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001345.1 Gene:AKR1C2 / 1646 HGNCID:385 Length:323 Species:Homo sapiens


Alignment Length:314 Identity:135/314 - (42%)
Similarity:185/314 - (58%) Gaps:11/314 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KHNDGTHIQGIGLGTFASTE---GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGV 71
            |.|||..:..:|.||:|..|   .....||..||:.|:.|||:|:.|.||.:||.|:|.|||:|.
Human     9 KLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGS 73

  Fly    72 IKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGE 136
            :||||||.|:|||.|.|.||.|..|..::|||:.||||||||||:|.|.|  ...|:||||.||:
Human    74 VKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVK--PGEEVIPKDENGK 136

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKK 199
            :....:|...||.||||..|.||.|||||||||...|..:|  ...|.||:.||:|.||..:|:|
Human   137 ILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRK 201

  Fly   200 LIALCKKNGILVTAFSPLGRHNAE----LRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTI 260
            |:..||...|::.|:|.||.|..|    ..:|..:.|..:.|:|.|:.::.|.:.:||.::.|.:
Human   202 LLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVV 266

  Fly   261 PLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            .|.||.|.:||.:|..||:|:|.:|:...:|..:...|............|||:
Human   267 VLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 131/296 (44%)
Tas 12..299 CDD:223739 130/295 (44%)
AKR1C2NP_001345.1 AKR_AKR1C1-35 6..308 CDD:381334 132/300 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.