DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and LOC1269450

DIOPT Version :10

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_308086.3 Gene:LOC1269450 / 1269450 VectorBaseID:AGAMI1_013431 Length:318 Species:Anopheles gambiae


Alignment Length:30 Identity:10/30 - (33%)
Similarity:15/30 - (50%) Gaps:7/30 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IFAPNN------GPVQFVH-HNKVNATTAE 166
            ||.|||      |..|.:. ||:..::.|:
Mosquito    11 IFHPNNAQFDKSGVQQTLDAHNEFRSSIAK 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 AKR_AKR2E1-5 7..299 CDD:381342 10/30 (33%)
LOC1269450XP_308086.3 AKR_SF 10..300 CDD:444925 10/30 (33%)

Return to query results.
Submit another query.