DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c20

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001298061.1 Gene:Akr1c20 / 116852 MGIID:2151104 Length:323 Species:Mus musculus


Alignment Length:311 Identity:133/311 - (42%)
Similarity:182/311 - (58%) Gaps:11/311 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTE---GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIK 73
            |||..|..:|.||.|..|   .....|...|||.|:||||.|..|.||.|||.|:|.||.:|.:|
Mouse    11 NDGHFIPILGFGTSAPQEVPRSKATEATKIAIDAGFRHIDCAAVYQNEKEVGLAIRSKIVDGTVK 75

  Fly    74 REDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVE 138
            |||||.|:|:|..||.||.|:....::||.:.||||||||||:|.:.| .|:| ..|||.||:..
Mouse    76 REDIFCTSKVWQTFHRPELVQVCLEQSLKQLQLDYVDLYLIHFPIAMK-PGEN-YFPKDENGKFI 138

  Fly   139 LVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLA--NCKIKPIHNQIEVHPALDQKKLI 201
            ...:|..|||.||||..|.||.|||||.|||..||.::|:  ..|.||:.||:|.||.|:|:||:
Mouse   139 YDAVDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQVECHPYLNQRKLL 203

  Fly   202 ALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPL 262
            ..|:...|::.|.|.||.:.    .:...|..:.|..:.::|.|||::.|.:.:||.::.|.:.|
Mouse   204 DFCRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIALRYQVQRGVVVL 268

  Fly   263 PKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPF 313
            .||...|||:||..||:|:|.:.|..:||..:...|...:..:.....:||
Mouse   269 AKSFIEKRIKENMQVFEFQLTSVDMKVLDGLNKNIRYIGSSISEDHPDFPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 130/294 (44%)
Tas 12..299 CDD:223739 130/295 (44%)
Akr1c20NP_001298061.1 ARA1 5..317 CDD:223729 131/307 (43%)
Tas 16..297 CDD:223739 125/282 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.