DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1b3

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_033788.3 Gene:Akr1b3 / 11677 MGIID:1353494 Length:316 Species:Mus musculus


Alignment Length:308 Identity:155/308 - (50%)
Similarity:202/308 - (65%) Gaps:7/308 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIKRED 76
            |:||.:..:||||:.|..|....||..|||:||||||.|..|.||.|||.|:::|:.|.|:||:|
Mouse     8 NNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQD 72

  Fly    77 IFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVD 141
            :||.:||||.||:...|:.|.:|||.::.|||:||||||||..:|...|  ..|.||:|.|...|
Mouse    73 LFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPD--YFPLDASGNVIPSD 135

  Fly   142 IDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLIALC 204
            .|::|||.|||:|||.||.|:|||||||..|:.|:|  ...|.||..||||.||.|.|:|||..|
Mouse   136 TDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYC 200

  Fly   205 KKNGILVTAFSPLG---RHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPLPKSS 266
            ...||:|||:||||   |..|:...|:.:.|.:::|||.||||:.|||:||:.|:...:.:|||.
Mouse   201 HSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSV 265

  Fly   267 NPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            .|.||.||..||||::.:||.|.|.||:...||.......|.|.|||:
Mouse   266 TPVRIAENLKVFDFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 148/290 (51%)
Tas 12..299 CDD:223739 148/291 (51%)
Akr1b3NP_033788.3 ARA1 1..297 CDD:223729 148/290 (51%)
Tas 8..289 CDD:223739 145/282 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1770
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.