DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c14

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_598833.1 Gene:Akr1c14 / 105387 MGIID:2145458 Length:323 Species:Mus musculus


Alignment Length:311 Identity:130/311 - (41%)
Similarity:182/311 - (58%) Gaps:11/311 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFAS---TEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIK 73
            |||..|..:|.||...   .:.:..:|...|||.|:||.|:||.|..|.|||.|:|.||.:|.:|
Mouse    11 NDGHFIPALGFGTTVPDKVPKDELIKATKIAIDTGFRHFDSAYLYQIEEEVGQAIRSKIEDGTVK 75

  Fly    74 REDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVE 138
            |||||.|:|||..||.||.|.....|||||..|||||||:||:|.:.: .|| :|.|:|.:|::.
Mouse    76 REDIFYTSKLWSTFHRPELVRSCLEKTLKNAQLDYVDLYIIHFPMALQ-PGD-KLFPRDEHGKLL 138

  Fly   139 LVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLI 201
            ...:|..|||.||||..|.||.|||||||||..||..:|  ...|.||:.||:|.|..|:|.:::
Mouse   139 AEAVDLCDTWEAMEKCKDAGLAKSIGVSNFNFRQLETILNKPGLKYKPVCNQVECHLYLNQSQML 203

  Fly   202 ALCKKNGILVTAFSPLGRHNAEL----RTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPL 262
            ..||...|::.::..||....::    ::|..:.|..:.|:|:||.::.|.:.|||.::.|.:.|
Mouse   204 DYCKSKDIILVSYCTLGSSRDKIWVDQKSPVLLDDPVLCAMANKYKQTPALIAIRYQLQRGIVVL 268

  Fly   263 PKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPF 313
            .:|...|||:|...||:|:|.:||..:||..|...|...|........:||
Mouse   269 TRSFKEKRIKEFMKVFEFQLASEDMKVLDGLHRNLRYNTASYFDDHPNHPF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 126/294 (43%)
Tas 12..299 CDD:223739 126/295 (43%)
Akr1c14NP_598833.1 AKR_AKR1C1-35 6..308 CDD:381334 127/298 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.