DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and LOC101733893

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_031746807.1 Gene:LOC101733893 / 101733893 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:276 Identity:128/276 - (46%)
Similarity:170/276 - (61%) Gaps:11/276 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFAS---TEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIK 73
            |||..:..:|.||:|.   .:...|.....||||||||||.|:.||||.|||.|::.|||:|.:|
 Frog    12 NDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIADGTVK 76

  Fly    74 REDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVE 138
            |||:|.|.|||..||.||||..|..|:|.::.|||:||::||.|..:| .||:.| |.|.||:..
 Frog    77 REDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFK-PGDDPL-PLDENGKPI 139

  Fly   139 LVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQKKLI 201
            ..:.|..|||.|:||..|.||.:||||||||.:||..:|  ...|.||:.||:|.|..|||.||:
 Frog   140 FHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLDQSKLL 204

  Fly   202 ALCKKNGILVTAFSPLGRHNAE----LRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTIPL 262
            ..||...|::.|:..||....|    ..||..:.:..:.|||.|:|::.|.|.:||:::.|.:.|
 Frog   205 EFCKSKDIVLVAYGVLGSSREENWVDQSTPVLLENPILGAIAKKHNRTPAHVAMRYLLQRGVVVL 269

  Fly   263 PKSSNPKRIEENFNVF 278
            .||..|.||:|||.||
 Frog   270 AKSFTPARIKENFKVF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 128/276 (46%)
Tas 12..299 CDD:223739 128/276 (46%)
LOC101733893XP_031746807.1 AKR_AKR1C1-35 7..286 CDD:381334 128/276 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.