DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mge and tomm22

DIOPT Version :9

Sequence 1:NP_523910.1 Gene:mge / 38459 FlyBaseID:FBgn0035473 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001039252.1 Gene:tomm22 / 734118 XenbaseID:XB-GENE-951173 Length:126 Species:Xenopus tropicalis


Alignment Length:114 Identity:57/114 - (50%)
Similarity:75/114 - (65%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VAATSNDPQRENYDDEPDETASERFWGLTEMFPEPVRNAVGAVSSATVKSVKGFYSFSCNASWIF 96
            ||.:.:..:.:..|:|.:||.|||.|||||||||.:|.|.||....::.:.|.|||||..|.||.
 Frog    12 VARSPSIEEEDEDDEELEETLSERLWGLTEMFPESLRTAAGASMDLSICAAKKFYSFSRTALWIG 76

  Fly    97 FTSAVILFAPVIFETERAQMEELHKSQQKQVLLGPGSAMGPGGPSPSLP 145
            .||.:||..||:||||:.|||:..:.||:|:||||.:.|  .||.|.||
 Frog    77 TTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPSTGM--SGPLPPLP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgeNP_523910.1 Tom22 16..145 CDD:299761 55/112 (49%)
tomm22NP_001039252.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7603
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10638
Inparanoid 1 1.050 111 1.000 Inparanoid score I4734
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625053at2759
OrthoFinder 1 1.000 - - FOG0005739
OrthoInspector 1 1.000 - - oto102401
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.