DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mge and TOMM22

DIOPT Version :9

Sequence 1:NP_523910.1 Gene:mge / 38459 FlyBaseID:FBgn0035473 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_064628.1 Gene:TOMM22 / 56993 HGNCID:18002 Length:142 Species:Homo sapiens


Alignment Length:137 Identity:58/137 - (42%)
Similarity:83/137 - (60%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SGMSSLGGSKDETPERRAVAATSNDPQ---RENYDDEPDETASERFWGLTEMFPEPVRNAVGAVS 75
            :.:::.|..:.::|:.......:..|:   .|:.|:|.|||.|||.|||||||||.||:|.||..
Human     3 AAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATF 67

  Fly    76 SATVKSVKGFYSFSCNASWIFFTSAVILFAPVIFETERAQMEELHKSQQKQVLLGPGSAMGPGGP 140
            ..::...:..|.||..|.||..||.:||..||:||||:.|||:..:.||:|:||||.:.:..|.|
Human    68 DLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMP 132

  Fly   141 S--PSLP 145
            .  ||||
Human   133 GALPSLP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgeNP_523910.1 Tom22 16..145 CDD:299761 56/133 (42%)
TOMM22NP_064628.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 6/38 (16%)
Import sequence, necessary for mitochondrion outer membrane localization and integration in the TOM complex. /evidence=ECO:0000250 41..50 6/8 (75%)
TMD, necessary for mitochondrion outer membrane localization and integration in the TOM complex. /evidence=ECO:0000250 83..103 10/19 (53%)
C-tail signal, necessary for mitochondrion outer membrane localization and integration in the TOM complex. /evidence=ECO:0000250 123..142 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158801
Domainoid 1 1.000 86 1.000 Domainoid score I8144
eggNOG 1 0.900 - - E1_KOG4111
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10638
Inparanoid 1 1.050 108 1.000 Inparanoid score I4928
Isobase 1 0.950 - 0 Normalized mean entropy S3758
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625053at2759
OrthoFinder 1 1.000 - - FOG0005739
OrthoInspector 1 1.000 - - oto88525
orthoMCL 1 0.900 - - OOG6_107973
Panther 1 1.100 - - LDO PTHR12504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3481
SonicParanoid 1 1.000 - - X6220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.