Sequence 1: | NP_523910.1 | Gene: | mge / 38459 | FlyBaseID: | FBgn0035473 | Length: | 148 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064628.1 | Gene: | TOMM22 / 56993 | HGNCID: | 18002 | Length: | 142 | Species: | Homo sapiens |
Alignment Length: | 137 | Identity: | 58/137 - (42%) |
---|---|---|---|
Similarity: | 83/137 - (60%) | Gaps: | 5/137 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 SGMSSLGGSKDETPERRAVAATSNDPQ---RENYDDEPDETASERFWGLTEMFPEPVRNAVGAVS 75
Fly 76 SATVKSVKGFYSFSCNASWIFFTSAVILFAPVIFETERAQMEELHKSQQKQVLLGPGSAMGPGGP 140
Fly 141 S--PSLP 145 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mge | NP_523910.1 | Tom22 | 16..145 | CDD:299761 | 56/133 (42%) |
TOMM22 | NP_064628.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..42 | 6/38 (16%) | |
Import sequence, necessary for mitochondrion outer membrane localization and integration in the TOM complex. /evidence=ECO:0000250 | 41..50 | 6/8 (75%) | |||
TMD, necessary for mitochondrion outer membrane localization and integration in the TOM complex. /evidence=ECO:0000250 | 83..103 | 10/19 (53%) | |||
C-tail signal, necessary for mitochondrion outer membrane localization and integration in the TOM complex. /evidence=ECO:0000250 | 123..142 | 7/17 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165158801 | |
Domainoid | 1 | 1.000 | 86 | 1.000 | Domainoid score | I8144 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4111 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H10638 | |
Inparanoid | 1 | 1.050 | 108 | 1.000 | Inparanoid score | I4928 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3758 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1625053at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0005739 | |
OrthoInspector | 1 | 1.000 | - | - | oto88525 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_107973 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR12504 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3481 |
SonicParanoid | 1 | 1.000 | - | - | X6220 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
16 | 15.740 |