DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mge and tomm22

DIOPT Version :9

Sequence 1:NP_523910.1 Gene:mge / 38459 FlyBaseID:FBgn0035473 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001001724.1 Gene:tomm22 / 321232 ZFINID:ZDB-GENE-030131-9810 Length:134 Species:Danio rerio


Alignment Length:139 Identity:56/139 - (40%)
Similarity:78/139 - (56%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IEFIEKDSGMSSLGGSKDETPERRAVAATSNDPQRENYDDEPDETASERFWGLTEMFPEPVRNAV 71
            |:.:..|||.......:||.             :.::.|:|.|||..||.||||||||:.||:|.
Zfish     4 IQELSPDSGRVETRPPEDEI-------------EGDDEDEELDETMLERLWGLTEMFPDSVRSAA 55

  Fly    72 GAVSSATVKSVKGFYSFSCNASWIFFTSAVILFAPVIFETERAQMEELHKSQQKQVLLGPGSAMG 136
            ...:..::.:.|..||||..|.|:..||.:||..||:|||||.|:|:....||:|:||||.:.|.
Zfish    56 EVSAHCSLSAAKKLYSFSRAALWVGTTSFMILVLPVVFETERLQLEQQQIQQQRQILLGPNAGMS 120

  Fly   137 PGGPSPSLP 145
             ||.|..:|
Zfish   121 -GGMSGMMP 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgeNP_523910.1 Tom22 16..145 CDD:299761 51/128 (40%)
tomm22NP_001001724.1 Tom22 <35..>90 CDD:299761 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594744
Domainoid 1 1.000 82 1.000 Domainoid score I8404
eggNOG 1 0.900 - - E1_KOG4111
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5012
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625053at2759
OrthoFinder 1 1.000 - - FOG0005739
OrthoInspector 1 1.000 - - oto41235
orthoMCL 1 0.900 - - OOG6_107973
Panther 1 1.100 - - LDO PTHR12504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3481
SonicParanoid 1 1.000 - - X6220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.