DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mge and tom22

DIOPT Version :9

Sequence 1:NP_523910.1 Gene:mge / 38459 FlyBaseID:FBgn0035473 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_593585.1 Gene:tom22 / 2542276 PomBaseID:SPAC17H9.16 Length:144 Species:Schizosaccharomyces pombe


Alignment Length:139 Identity:36/139 - (25%)
Similarity:61/139 - (43%) Gaps:19/139 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IEKDSGMSSLGGSKDETPERRAVAATSNDPQRENYDDEPDETASERFWGLTEMFPEP--VRNAVG 72
            ||||..:.    ::::..|        :|....:::...:||..:|...|.|:.|..  |:.|.|
pombe    21 IEKDQYIY----AQEDVEE--------SDSDESDFEGLEEETIIDRIAALKEIVPVTWRVKIADG 73

  Fly    73 AVSSATVKSVKGFYSFSCNASWIFFTSAVILFAPVIFE-TERAQMEELHKSQQKQVLLGPGSAMG 136
            |.::.|  .:.....|...:.|:..|||::|..|.:.. .|.||:.|..|..:.|  .|....:.
pombe    74 AKTATT--GLSKLAQFGGKSMWVISTSALLLGVPFMMSLEEEAQLTEYEKQIKDQ--RGANEVIA 134

  Fly   137 PGGPSPSLP 145
            ||..|.:||
pombe   135 PGATSGALP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mgeNP_523910.1 Tom22 16..145 CDD:299761 30/131 (23%)
tom22NP_593585.1 3a0801s05tom22 1..144 CDD:273379 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4111
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I2095
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.