DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sc2 and CER10

DIOPT Version :9

Sequence 1:NP_647836.2 Gene:Sc2 / 38457 FlyBaseID:FBgn0035471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_191096.1 Gene:CER10 / 824702 AraportID:AT3G55360 Length:310 Species:Arabidopsis thaliana


Alignment Length:321 Identity:121/321 - (37%)
Similarity:171/321 - (53%) Gaps:45/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EILNAKNSKPYGKVKVPSGATPIGDLRALIHK------------TLKQTPHANRQSLRLELKGKS 56
            |:|.|       .:.:|..|| :.||:...||            ||..||.:..:.:.|..| ||
plant    12 EVLKA-------PLDLPDSAT-VADLQEAFHKRAKKFYPSRQRLTLPVTPGSKDKPVVLNSK-KS 67

  Fly    57 LKDTDTLESLSLRSGDKIYVKDLGPQIGWKTVFLAEYAGPLIVYLIFYFRPE---LVYGKAASLP 118
            ||:.....:.||    .:..||||.|:.::|:|..||.|||::|.:||:.|.   |.||:...:.
plant    68 LKEYCDGNNNSL----TVVFKDLGAQVSYRTLFFFEYLGPLLIYPVFYYFPVYKFLGYGEDCVIH 128

  Fly   119 ISLTTHIAAGCYTVHYVKRLLETIFVHRFSHATMPLRNLFKNCTYYWGFTAYVSYHVNHPQFTSP 183
            ...|..:...|:  ||.||:|||.|||||||||.|:.|:|:||.|||.|.||::|:||||.:|..
plant   129 PVQTYAMYYWCF--HYFKRILETFFVHRFSHATSPIGNVFRNCAYYWSFGAYIAYYVNHPLYTPV 191

  Fly   184 CMCTVWGALGAFALCELGNFSVHIALRNLRPPGTKVRKIPVADGNPLTK--LFDLVSCPNYTYEI 246
            ....:....|...:|::.||..||.|:|||.|..       |.|..:.:  ||::|:|.|||.||
plant   192 SDLQMKIGFGFGLVCQVANFYCHILLKNLRDPSG-------AGGYQIPRGFLFNIVTCANYTTEI 249

  Fly   247 GAWVSFSVLTSCLAAYLFAFAGAFQMTIWALAKHRNYKKEF--KD----YPRQRRSIFPFV 301
            ..|:.|::.|..:|.|:|....|..||.|||.||...:|.|  ||    |||:...:.||:
plant   250 YQWLGFNIATQTIAGYVFLAVAALIMTNWALGKHSRLRKIFDGKDGKPKYPRRWVILPPFL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sc2NP_647836.2 Tsc13_N 3..79 CDD:176396 23/86 (27%)
PLN02560 15..299 CDD:178174 116/306 (38%)
PEMT 150..302 CDD:304400 64/160 (40%)
CER10NP_191096.1 PLN02560 1..310 CDD:178174 120/319 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1991
eggNOG 1 0.900 - - E1_KOG1639
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36231
Inparanoid 1 1.050 187 1.000 Inparanoid score I1404
OMA 1 1.010 - - QHG53957
OrthoDB 1 1.010 - - D720263at2759
OrthoFinder 1 1.000 - - FOG0001630
OrthoInspector 1 1.000 - - oto3377
orthoMCL 1 0.900 - - OOG6_102127
Panther 1 1.100 - - LDO PTHR10556
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1032
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.