DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sc2 and SPBC646.07c

DIOPT Version :9

Sequence 1:NP_647836.2 Gene:Sc2 / 38457 FlyBaseID:FBgn0035471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_595365.1 Gene:SPBC646.07c / 2541070 PomBaseID:SPBC646.07c Length:295 Species:Schizosaccharomyces pombe


Alignment Length:260 Identity:116/260 - (44%)
Similarity:151/260 - (58%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GKSLKDTDTLESLSLRSGDKIYVKDLGPQIGWKTVFLAEYAGPLIVYLIFYFRPELVYGKAASLP 118
            |.:|....||....:..|..|:||||||||||:|||:.||.|||:::|.|....:.:|.|..:| 
pombe    52 GTTLLPNTTLRKYGVGPGATIWVKDLGPQIGWRTVFMIEYLGPLVIHLFFILNYKWIYRKDYNL- 115

  Fly   119 ISLTTHIAAGCYTVHYVKRLLETIFVHRFSHATMPLRNLFKNCTYYW---G-FTAYVSY---HVN 176
             .|...||.....:|::||..|:|||||||.|||||||:||||.:|.   | |.||..|   |.|
pombe   116 -CLNQKIAFVLVMLHFMKREYESIFVHRFSLATMPLRNIFKNCAHYHLLSGLFLAYFIYGPWHAN 179

  Fly   177 HPQFTSP----CMCTVWGALGAFALCELGNFSVHIALRNLRPPGTKVRKIPVADGNPLTKLFDLV 237
              .:..|    .:...|    |||:  |.||..||.||:|||.|:|.|.||...|      |:||
pombe   180 --DYIKPNHLLFLIVGW----AFAV--LSNFRTHIILRDLRPAGSKKRVIPTGYG------FNLV 230

  Fly   238 SCPNYTYEIGAWVSFSVLTSCLAAYLFAFAGAFQMTIWALAKHRNYKKEFKDYPRQRRSIFPFVL 302
            |.|||.:|...|:.|::||...|:::|.|.|:.||.:||..||..|.|||.:|||.|:.:.||.|
pombe   231 SFPNYFFESLGWLFFALLTKSWASWIFLFVGSAQMFVWAKKKHARYLKEFPNYPRSRKIMIPFFL 295

  Fly   303  302
            pombe   296  295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sc2NP_647836.2 Tsc13_N 3..79 CDD:176396 8/24 (33%)
PLN02560 15..299 CDD:178174 113/255 (44%)
PEMT 150..302 CDD:304400 72/162 (44%)
SPBC646.07cNP_595365.1 PLN02560 1..294 CDD:178174 114/257 (44%)
UBQ 18..72 CDD:294102 5/19 (26%)
Steroid_dh 146..295 CDD:251363 72/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1505
eggNOG 1 0.900 - - E1_KOG1639
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36231
Inparanoid 1 1.050 194 1.000 Inparanoid score I1028
OMA 1 1.010 - - QHG53957
OrthoFinder 1 1.000 - - FOG0001630
OrthoInspector 1 1.000 - - oto101787
orthoMCL 1 0.900 - - OOG6_102127
Panther 1 1.100 - - LDO PTHR10556
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2319
SonicParanoid 1 1.000 - - X1032
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.