DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sc2 and TECRL

DIOPT Version :9

Sequence 1:NP_647836.2 Gene:Sc2 / 38457 FlyBaseID:FBgn0035471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001010874.2 Gene:TECRL / 253017 HGNCID:27365 Length:363 Species:Homo sapiens


Alignment Length:308 Identity:118/308 - (38%)
Similarity:185/308 - (60%) Gaps:12/308 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELEILNAKNSKPYGKVKVPSGATPIGDLRALIHKTLKQTPHANRQSLRLELKGKSLKDTDTLESL 66
            |:||.:|:..|....:...:.::.|.|::...||...:. :.:|..|:||..|..|||..|::|:
Human    61 EIEIFDAQTRKQICILDKVTQSSTIHDVKQKFHKACPKW-YPSRVGLQLECGGPFLKDYITIQSI 124

  Fly    67 SLRSGDKIYVKDLGPQIGWKTVFLAEYAGPLIVYLIFYFRPELVY-GKAASL----PISLTTHIA 126
            :..|...:|..|||.|:.|.|||||||.|||::||:||.|...:| ||.::.    |:   .|:|
Human   125 AASSIVTLYATDLGQQVSWTTVFLAEYTGPLLIYLLFYLRIPCIYDGKESARRLRHPV---VHLA 186

  Fly   127 AGCYTVHYVKRLLETIFVHRFSHATMPLRNLFKNCTYYWGFTAYVSYHVNHPQFTSPCMCTVWGA 191
            ..|:.:||::.||||:|||:.|....||:||..:|.:|||||::::|::|||.:|.|........
Human   187 CFCHCIHYIRYLLETLFVHKVSAGHTPLKNLIMSCAFYWGFTSWIAYYINHPLYTPPSFGNRQIT 251

  Fly   192 LGA--FALCELGNFSVHIALRNLRPPGTKVRKIPVADGNPLTKLFDLVSCPNYTYEIGAWVSFSV 254
            :.|  |.:||.||..:::.|.:....|... ..|..:.||.|.:|.||||||||||||:|:||:|
Human   252 VSAINFLICEAGNHFINVMLSHPNHTGNNA-CFPSPNYNPFTWMFFLVSCPNYTYEIGSWISFTV 315

  Fly   255 LTSCLAAYLFAFAGAFQMTIWALAKHRNYKKEFKDYPRQRRSIFPFVL 302
            :|..|...:|....:.||::||..||:.|.::|..|..::.::.||:|
Human   316 MTQTLPVGIFTLLMSIQMSLWAQKKHKIYLRKFNSYIHRKSAMIPFIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sc2NP_647836.2 Tsc13_N 3..79 CDD:176396 20/75 (27%)
PLN02560 15..299 CDD:178174 110/290 (38%)
PEMT 150..302 CDD:304400 59/153 (39%)
TECRLNP_001010874.2 UBQ 62..137 CDD:294102 20/75 (27%)
PEMT 212..363 CDD:304400 59/151 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145631
Domainoid 1 1.000 132 1.000 Domainoid score I5114
eggNOG 1 0.900 - - E1_KOG1639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 330 1.000 Inparanoid score I2450
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53957
OrthoDB 1 1.010 - - D537031at33208
OrthoFinder 1 1.000 - - FOG0001630
OrthoInspector 1 1.000 - - otm41880
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10556
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1032
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.